katagami
GalleryPalettesArt StylesStudioBake-offMCP
型紙
katagamino.002

A DESIGN.md-compatible library of design languages.

say hi
Give feedback
built by @arni0x9053 · 2026型紙 · v0.2.0
  • Languages
  • Palettes
  • Art Styles
  • Studio
back to art styles
Art lane

Wobblebook Mischief

illustration
workshop-garden scene
pencil-bird inventor portrait
wind-up teapot machine object
marginalia texture pattern
Prompt template
{subject}, Wobblebook Mischief messy whimsical sketchbook drawing, {palette} used only as three dry crayon or colored-pencil accent marks, continuous-line graphite contour, searching imperfect restated outlines, visible paper tooth, graphite dust, erased construction ghosts, wax-crayon frottage rub patches, stray marginal loops and tiny odd doodles, bright white page, tactile handmade mess with adult composition discipline
Slot recipes
hero — wide sketchbook spread with a single whimsical ecosystem or workshop-garden, generous negative space, hero-safe upper area, graphite first and sparse crayon accents
feature — one crooked hand-invented object centered on white paper, construction marks visible, color used as pressure marks and small accents
avatar — odd friendly portrait bust, oversized searching eyes or silhouette, messy restated graphite contour, a few crayon highlights only
empty-state — tiny unfinished doodle with erased construction ghosts, one color smudge, lots of white page around it
illustration — single motif with charming wobble, legible silhouette, layered graphite scribble and dry crayon overdraw
background — low-contrast paper tooth field with loops, rubbed texture, faint graphite dust, and sparse colored crayon marks
Credits · in the lineage of
  • Children's sketchbook picture-book illustrationTraditionloose crayon-and-doodle energy

A generated style is an aggregate of many influences — credit is given to the artists and traditions it draws on, not a claim of authorship.

produced by unrecorded · sourced by unrecorded · images by unrecorded

Do
  • · Keep the paper bright white and the drawing tactile: tooth, eraser ghosts, graphite dust, and pressure marks should be visible.
  • · Let the contour wander and search; repeated imperfect outlines are part of the voice.
  • · Use color like crayon found in the margin: tomato red, cobalt blue, and sunny yellow as accents, not full fills.
  • · Make subjects a little strange and handmade, but keep their overall silhouette readable.
Don't
  • · Do not polish into vector line art or clean editorial illustration.
  • · Do not use pastel washes, gradients, airbrush shading, or muddy tinted backgrounds.
  • · Do not imitate a living artist or include readable text, letters, watermarks, or emoji.
  • · Do not fill large areas with color; the graphite drawing should remain primary.
try it

remix with this style

Apply Wobblebook Mischief to any UI language and swap the palette — the preview takes this style's hero image.

UI language
Palette
Art style · fixed
Wobblebook Mischief
Landing PageAkte · Spectral Graphite Adaptive · Wobblebook Mischief
live preview · recolored + filled
pattern — marginalia-style arrangement of loops, flowers, stars, tiny creatures, frottage rubs, and erased circles on white paper
sketchbookmessy-sketchwhimsicalgraphitecolored-pencil